PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G11510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 302aa    MW: 31366.9 Da    PI: 6.6816
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G11510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-192065147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l  av+++G+++W++I+++++ gR++k+c++rw + 
  OMERI05G11510.1 20 KGSWSPEEDEQLRGAVARHGPRNWTAISEEVP-GRSGKSCRLRWCNQ 65
                     799*****************************.***********985 PP

2Myb_DNA-binding57.23.9e-1872115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T++Ed l+v a++++G++ W+tIar +  gRt++++k++w++
  OMERI05G11510.1  72 RRPFTPDEDALIVAAHAKYGNK-WATIARLLD-GRTDNSVKNHWNS 115
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4861570IPR017930Myb domain
SuperFamilySSF466892.16E-3017113IPR009057Homeodomain-like
SMARTSM007172.3E-161968IPR001005SANT/Myb domain
PfamPF002492.4E-192065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-242173IPR009057Homeodomain-like
CDDcd001679.46E-162264No hitNo description
PROSITE profilePS5129421.64571121IPR017930Myb domain
SMARTSM007172.7E-1571119IPR001005SANT/Myb domain
PfamPF002495.3E-1572115IPR001005SANT/Myb domain
CDDcd001672.81E-1274117No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2274120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MLIDGEGSSS SAAAAGGKIK GSWSPEEDEQ LRGAVARHGP RNWTAISEEV PGRSGKSCRL  60
RWCNQLSPGV HRRPFTPDED ALIVAAHAKY GNKWATIARL LDGRTDNSVK NHWNSSLRRN  120
RRAAAAAAAA AASVSYQSMD LTEEADNDDE GTSDDSVAIP AQSSPAAVVA GIPVLPPPPP  180
AKRLCVAAPI GVEHRASPPD PPTSLSLSPP GAAAAAISAS TVVGGSSAAR AEEEAVAREK  240
ARMEQDPWLM AMMRQMITEE VQRQVSVVYS LVASSAAVAA QTGNAGGVGR KGPDGRPSNG  300
QD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-34191193103C-Myb DNA-Binding Domain
1mse_C5e-34191193103C-Myb DNA-Binding Domain
1gv2_A5e-34191193103MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-331911957157MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-331911957157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1362210.0AC136221.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077J17, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639574.11e-165PREDICTED: transcription factor MYB44
TrEMBLA0A0E0DQB20.0A0A0E0DQB2_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g28320.11e-165(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-52myb domain protein r1